Structure of PDB 8f0m Chain B |
>8f0mB (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVPTKLEVVAATPTSLLVSWDAPAVTVVFYDITYGETGGNSPVQEFTVPG SKSTATISGLSPGVDYTITVYAKYLFWSGYSSPISINYRTE |
|
PDB | 8f0m Exploring switch II pocket conformation of KRAS(G12D) with mutant-selective monobody inhibitors. |
Chain | B |
Resolution | 2.44 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
GLC |
B |
F48 T58 I59 |
F46 T56 I57 |
|
|
|