Structure of PDB 8evz Chain B

Receptor sequence

>8evzB (length=313) Species: 208964 (Pseudomonas aeruginosa PAO1)

CLDSLLNGTQDPKAFGRVAVLFGGKSAEREVSLKSGAMVLQSLLAAGVDA
FGIDVGEDLLQRLVEEKIDRAFIILHGRGGEDGSMQGLLECAGIPYTGSG
VLASALAMDKLRTKRVWLSLGLPTPDYAVLASEDDCREAAQRLGFPLIVK
PAHEGSSIGMAKVGGLDELIAAWREAARYDSQVLVEQWISGPEFTVATLR
GQVLPAIRLGTPHTFYDYDAKYLASDTRYQVPCGLDEAKERELKELTARA
CDALGIQGWGRADVMQDAEGRFWLLEVNTAPGMTDHSLVPMAARAAGLDF
QQLVLAILADSRE

3D structure

• PDB: 8evz Comparative functional and structural analysis of Pseudomonas aeruginosa d-alanine-d-alanine ligase isoforms as prospective antibiotic targets.
• Chain: B
• Resolution: 2.45 Å

Enzymatic activity

• Enzyme Commision number: 6.3.2.4: D-alanine--D-alanine ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	E279 N281	E276 N278
BS02	MG	B	D266 E279	D263 E276
BS03	ADP	B	K113 I151 K153 G158 S160 M163 E189 W191 I192 E196 F218 Y219 L278 E279	K110 I148 K150 G155 S157 M160 E186 W188 I189 E193 F215 Y216 L275 E276
BS04	DS0	B	E31 S159 K224 Y225 R264 E279 N281 G285	E28 S156 K221 Y222 R261 E276 N278 G282

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0005524 ATP binding
• GO:0008716 D-alanine-D-alanine ligase activity
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0008360 regulation of cell shape
• GO:0009252 peptidoglycan biosynthetic process
• GO:0071555 cell wall organization

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8evz, PDBe:8evz, PDBj:8evz
• PDBsum: 8evz
• PubMed: 37581574
• UniProt: Q9LCT6|DDLB_PSEAE D-alanine--D-alanine ligase B (Gene Name=ddlB)