Structure of PDB 8etd Chain B

Receptor sequence
>8etdB (length=177) Species: 284812 (Schizosaccharomyces pombe 972h-) [Search protein sequence]
LRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGRHV
ELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEV
LHFCSSLPILLVACKADLRNDPKIIEELSKTNQHPVTTEEGQAVAQKIGA
YKYLECSAKTNEGVREVFESATRAAML
3D structure
PDB8etd Crystal Structure of Schizosaccharomyces pombe Rho1 Reveals Its Evolutionary Relationship with Other Rho GTPases.
ChainB
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B T19 T37 T16 T34
BS02 GDP B A15 G17 K18 T19 C20 F30 K118 D120 L121 A161 K162 A12 G14 K15 T16 C17 F27 K115 D117 L118 A158 K159
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0019003 GDP binding
GO:0019901 protein kinase binding
GO:0035591 signaling adaptor activity
Biological Process
GO:0007015 actin filament organization
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0030100 regulation of endocytosis
GO:0032955 regulation of division septum assembly
GO:0032956 regulation of actin cytoskeleton organization
GO:0032995 regulation of fungal-type cell wall biogenesis
GO:0060635 positive regulation of (1->3)-beta-D-glucan biosynthetic process
GO:0070610 regulation of fungal-type cell wall (1->3)-alpha-glucan biosynthetic process
GO:0090334 regulation of cell wall (1->3)-beta-D-glucan biosynthetic process
GO:0140281 positive regulation of mitotic division septum assembly
GO:0140748 positive regulation of regulation of ascospore wall (1->3)-beta-D-glucan biosynthetic process
GO:1905758 positive regulation of primary cell septum biogenesis
GO:2000769 regulation of establishment or maintenance of cell polarity regulating cell shape
Cellular Component
GO:0000935 division septum
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009898 cytoplasmic side of plasma membrane
GO:0031097 medial cortex
GO:0032153 cell division site
GO:0035838 growing cell tip
GO:0140453 protein aggregate center
GO:1902716 cell cortex of growing cell tip

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8etd, PDBe:8etd, PDBj:8etd
PDBsum8etd
PubMed36358328
UniProtQ09914|RHO1_SCHPO GTP-binding protein rho1 (Gene Name=rho1)

[Back to BioLiP]