Structure of PDB 8el4 Chain B

Receptor sequence

>8el4B (length=163) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

GKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCIVSDSVSGMVCEN
PSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGDSSVLEDRCLNGL
KETYASLGVPAAGNARTISIMKATVIGFITNNSQQKKLSTPAGDCSALAS
EVGGYFDKVSSAL

3D structure

PDB

8el4 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii

Chain

Resolution

1.73 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AX9	B	C50 D54 C61 R129 I133 A136 T137 S146 Q148	C37 D41 C48 R116 I120 A123 T124 S133 Q135
BS02	PEB	B	M59 G72 R77 A81 C82 R84 D85 I88 L113 L120 V122 N127	M46 G59 R64 A68 C69 R71 D72 I75 L100 L107 V109 N114
BS03	PEB	B	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	K15 N22 K23 M25 D26 I129 N131 T140 P141 A142 G143 C145
BS04	PEB	B	N76 R77	N63 R64
BS05	PEB	B	N76 R77	N63 R64

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8el4, PDBe:8el4, PDBj:8el4
PDBsum	8el4
PubMed	37957226
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]