Structure of PDB 8eka Chain B |
>8ekaB (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
IQMTQSPSTLSASVGDRVTITCRASQFISRWLAWYQQKPGKAPKLLIYKA SSLESGVPSRFSGSGSETHFTLTISSLQPDDVATYYCQEYTSYGRTFGQG TKVEIKR |
|
PDB | 8eka Cryo-EM structures of anti-malarial antibody L9 with circumsporozoite protein reveal trimeric L9 association and complete 27-residue epitope. |
Chain | B |
Resolution | 3.7 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
W32 R96 |
W31 R95 |
|
|
|