Structure of PDB 8e51 Chain B

Receptor sequence

>8e51B (length=206) Species: 310915 (Pangasianodon hypophthalmus)

NQPPRFQNYFFQSYLLIYENTPVGSSITQLTAVDPDGEPLIFGVVGEEAS
RFFAVQENTGVVWLRQPLDRETKSEMQVVFSVSDSQGVVKDTVNIQIGDV
NDNAPTFHNQPYTVNIPEDTSVGTSIFMVNATDPDQGTGGSVLFSFQPPS
PFFSIDGARGIITVSRLLDYEVTSAYQLTVNATDQDKLHPLSSLANLAIT
LSDIQD

3D structure

• PDB: 8e51 Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.
• Chain: B
• Resolution: 2.594 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	B	E20 D70 E72 D103	E19 D69 E71 D102
BS02	CA	B	E20 E72 D100 V101 D103 D136	E19 E71 D99 V100 D102 D135
BS03	CA	B	N102 N104 D134 D136 G140 D185	N101 N103 D133 D135 G139 D184
BS04	CA	B	N2 Q3 D35 D37 E39 D85	N1 Q2 D34 D36 E38 D84
BS05	CA	B	E119 E172 D204 I205 D207	E118 E171 D203 I204 D206
BS06	CA	B	E119 D170 E172 D207	E118 D169 E171 D206

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Nov 27 11:38:45 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '8e51', asym_id = 'B', title = 'Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='8e51', asym_id='B', title='Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005509,0005886,0007155,0007156,0016020', uniprot = '', pdbid = '8e51', asym_id = 'B'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509,0005886,0007155,0007156,0016020', uniprot='', pdbid='8e51', asym_id='B')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>