Structure of PDB 8e3d Chain B

Receptor sequence

>8e3dB (length=114) Species: 9606 (Homo sapiens) [Search protein sequence]

GSAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKV
HMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVR
SDHLHRHLKKDGCN

3D structure

PDB

8e3d Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.

Chain

Resolution

2.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	K389 Q392 R399 H400 T403 R421 Y451 R458 R464 K473 V476 R477 H480 R483	K12 Q15 R22 H23 T26 R44 Y74 R81 R87 K96 V99 R100 H103 R106
BS02	dna	B	K396 Q422 K426 Y438 K454 S478 D479 H482	K19 Q45 K49 Y61 K77 S101 D102 H105
BS03	ZN	B	C412 C415 H428 H432	C35 C38 H51 H55
BS04	ZN	B	C384 C387 H400 H404	C7 C10 H23 H27
BS05	ZN	B	C440 C443 H456 H460	C63 C66 H79 H83
BS06	ZN	B	C468 C471 H484	C91 C94 H107

External links

PDB	RCSB:8e3d, PDBe:8e3d, PDBj:8e3d
PDBsum	8e3d
PubMed	36626981
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]