Structure of PDB 8e0a Chain B

Receptor sequence

>8e0aB (length=176) Species: 9606 (Homo sapiens) [Search protein sequence]

SSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRVPTLHPTSEELTI
AGMTFTTFDLGRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDE
TIANVPILILGNKIDRPEAISEERLREMFGLYGQTTGKGSISLKELNARP
LEVFMCSVLKRQGYGEGFRWMAQYID

3D structure

PDB

8e0a The alarmone ppGpp selectively inhibits the isoform A of the human small GTPase Sar1.

Chain

Resolution

1.797 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	B	N35 G37 K38 T39 T40 H58 N134 K135 D137 R138 S179 L181	N23 G25 K26 T27 T28 H42 N112 K113 D115 R116 S157 L159

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0003925	G protein activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0046872	metal ion binding
GO:0140785	amino acid sensor activity

	Biological Process
GO:0002474	antigen processing and presentation of peptide antigen via MHC class I
GO:0003400	regulation of COPII vesicle coating
GO:0006886	intracellular protein transport
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0015031	protein transport
GO:0016050	vesicle organization
GO:0016192	vesicle-mediated transport
GO:0032368	regulation of lipid transport
GO:0042953	lipoprotein transport
GO:0048208	COPII vesicle coating
GO:0055088	lipid homeostasis
GO:0061024	membrane organization
GO:0070863	positive regulation of protein exit from endoplasmic reticulum
GO:0090110	COPII-coated vesicle cargo loading
GO:0140353	lipid export from cell
GO:1903432	regulation of TORC1 signaling
GO:1904262	negative regulation of TORC1 signaling
GO:1990253	cellular response to leucine starvation

	Cellular Component
GO:0005737	cytoplasm
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0012507	ER to Golgi transport vesicle membrane
GO:0016020	membrane
GO:0030127	COPII vesicle coat
GO:0032580	Golgi cisterna membrane
GO:0070971	endoplasmic reticulum exit site

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8e0a, PDBe:8e0a, PDBj:8e0a
PDBsum	8e0a
PubMed	36369712
UniProt	Q9Y6B6\|SAR1B_HUMAN Small COPII coat GTPase SAR1B (Gene Name=SAR1B)

[Back to BioLiP]