Structure of PDB 8dyo Chain B

Receptor sequence
>8dyoB (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
GEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTN
FGEIKFDVWDTAGLEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWH
RDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNY
NFEKPFLWLARKLAGNPQLEF
3D structure
PDB8dyo Structure of IMPORTIN-4 bound to the H3-H4-ASF1 histone-histone chaperone complex.
ChainB
Resolution7.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B G24 T27 G17 T20
BS02 GTP B G22 T23 G24 F37 K39 Y41 K125 G15 T16 G17 F30 K32 Y34 K118
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000467 exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006606 protein import into nucleus
GO:0006913 nucleocytoplasmic transport
GO:0006997 nucleus organization
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0046822 regulation of nucleocytoplasmic transport
GO:1901987 regulation of cell cycle phase transition
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dyo, PDBe:8dyo, PDBj:8dyo
PDBsum8dyo
PubMed36103578
UniProtP32835|GSP1_YEAST GTP-binding nuclear protein GSP1/CNR1 (Gene Name=GSP1)

[Back to BioLiP]