Structure of PDB 8dvi Chain B

Receptor sequence

>8dviB (length=432) Species: 2681598 (Escherichia phage T4)

MVEIILSHLIFDQAYFSKVWPYMDSEYFESGPAKNTFKLIKSHVNEYHSV
PSINALNVALENSSFTETEYSGVKTLISKLADSPEDHSWLVKETEKYVQQ
RAMFNATSKIIEIQTNAELPPEKRNKKMPDVGAIPDIMRQALSISFDSYV
GHDWMDDYEARWLSYMNKARKVPFKLRILNKITKGGAETGTLNVLMAGVN
VGKSLGLCSLAADYLQLGHNVLYISMEMAEEVCAKRIDANMLDVSLDDID
DGHISYAEYKGKMEKWREKSTLGRLIVKQYPTGGADANTFRSLLNELKLK
KNFVPTIIIVDYLGICKSCRIRVYSENSYTTVKAIAEELRALAVETETVL
WTAAQVGKQAWDSSDVNMSDIAESAGLPATADFMLAVIETEELAAAEQQL
IKQIKSRYGDKNKWNKFLMGVQKGNQKWVEIE

3D structure

• PDB: 8dvi Structural basis of the T4 bacteriophage primosome assembly and primer synthesis.
• Chain: B
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	K358 A372 A375	K358 A372 A375
BS02	AGS	B	V199 N200 G202 K203 S204 R236 L246 K423	V199 N200 G202 K203 S204 R236 L246 K423
BS03	MG	B	S204 E227	S204 E227
BS04	AGS	B	A379 K405 R407 Y408 G409	A379 K405 R407 Y408 G409

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0004386 helicase activity
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0017116 single-stranded DNA helicase activity

Biological Process

• GO:0006260 DNA replication
• GO:0006268 DNA unwinding involved in DNA replication
• GO:0006269 DNA replication, synthesis of primer
• GO:0032508 DNA duplex unwinding
• GO:0039686 bidirectional double-stranded viral DNA replication
• GO:0039693 viral DNA genome replication

Cellular Component

• GO:0005829 cytosol
• GO:1990077 primosome complex

External links

• PDB: RCSB:8dvi, PDBe:8dvi, PDBj:8dvi
• PDBsum: 8dvi
• PubMed: 37474605
• UniProt: P04530|HELIC_BPT4 DnaB-like replicative helicase (Gene Name=41)