Structure of PDB 8dtm Chain B

Receptor sequence

>8dtmB (length=340) Species: 10090 (Mus musculus) [Search protein sequence]

QASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQN
VVVDIDPPQRSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDII
YVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQA
EDSELFELDYCLKGLKLPSRKELEESSFRKTFEDYLHHRPFEKVVNKESL
VISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKADDIVGPV
THEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFAL
ERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDY

3D structure

PDB

8dtm Activation of the insulin receptor by an insulin mimetic peptide.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	R479 L486 R488 P537 Q538 G552 W553 L554 R556	R15 L22 R24 P58 Q59 G64 W65 L66 R68

Gene Ontology

	Molecular Function
GO:0001540	amyloid-beta binding
GO:0004672	protein kinase activity
GO:0004713	protein tyrosine kinase activity
GO:0004714	transmembrane receptor protein tyrosine kinase activity
GO:0005009	insulin receptor activity
GO:0005159	insulin-like growth factor receptor binding
GO:0005515	protein binding
GO:0005524	ATP binding
GO:0005525	GTP binding
GO:0019904	protein domain specific binding
GO:0030295	protein kinase activator activity
GO:0031994	insulin-like growth factor I binding
GO:0031995	insulin-like growth factor II binding
GO:0043548	phosphatidylinositol 3-kinase binding
GO:0043559	insulin binding
GO:0043560	insulin receptor substrate binding
GO:0044877	protein-containing complex binding
GO:0051425	PTB domain binding

	Biological Process
GO:0001934	positive regulation of protein phosphorylation
GO:0002092	positive regulation of receptor internalization
GO:0003007	heart morphogenesis
GO:0006355	regulation of DNA-templated transcription
GO:0006468	protein phosphorylation
GO:0007169	cell surface receptor protein tyrosine kinase signaling pathway
GO:0007186	G protein-coupled receptor signaling pathway
GO:0008284	positive regulation of cell population proliferation
GO:0008286	insulin receptor signaling pathway
GO:0008544	epidermis development
GO:0008584	male gonad development
GO:0009887	animal organ morphogenesis
GO:0016310	phosphorylation
GO:0018108	peptidyl-tyrosine phosphorylation
GO:0030238	male sex determination
GO:0030325	adrenal gland development
GO:0030335	positive regulation of cell migration
GO:0031017	exocrine pancreas development
GO:0031623	receptor internalization
GO:0032148	activation of protein kinase B activity
GO:0032869	cellular response to insulin stimulus
GO:0042593	glucose homeostasis
GO:0043406	positive regulation of MAP kinase activity
GO:0043410	positive regulation of MAPK cascade
GO:0045429	positive regulation of nitric oxide biosynthetic process
GO:0045725	positive regulation of glycogen biosynthetic process
GO:0045821	positive regulation of glycolytic process
GO:0045840	positive regulation of mitotic nuclear division
GO:0045893	positive regulation of DNA-templated transcription
GO:0045995	regulation of embryonic development
GO:0046326	positive regulation of D-glucose import
GO:0046718	symbiont entry into host cell
GO:0046777	protein autophosphorylation
GO:0048639	positive regulation of developmental growth
GO:0051446	positive regulation of meiotic cell cycle
GO:0051897	positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0060267	positive regulation of respiratory burst
GO:0071363	cellular response to growth factor stimulus
GO:2000194	regulation of female gonad development

	Cellular Component
GO:0005635	nuclear envelope
GO:0005764	lysosome
GO:0005768	endosome
GO:0005770	late endosome
GO:0005886	plasma membrane
GO:0005899	insulin receptor complex
GO:0005901	caveola
GO:0016020	membrane
GO:0031981	nuclear lumen
GO:0043235	receptor complex
GO:0055038	recycling endosome membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8dtm, PDBe:8dtm, PDBj:8dtm
PDBsum	8dtm
PubMed	36151101
UniProt	P15208\|INSR_MOUSE Insulin receptor (Gene Name=Insr)

[Back to BioLiP]