Structure of PDB 8dgt Chain B

Receptor sequence
>8dgtB (length=311) Species: 9606 (Homo sapiens) [Search protein sequence]
DEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGL
VMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVK
PSNILVNSRGEIKLCDFGVSGQLIDAMANAFVGTRSYMSPERLQGTHYSV
QSDIWSMGLSLVEMAVGRYPIPPPDAKELELMPMAIFELLDYIVNEPPPK
LPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGW
LCSTIGLNQPS
3D structure
PDB8dgt Cryo-EM structure of a RAS/RAF recruitment complex.
ChainB
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.12.2: mitogen-activated protein kinase kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B N195 D208 N153 D166
BS02 AGS B G77 K97 M143 Q153 D190 K192 S194 L197 G35 K55 M101 Q111 D148 K150 S152 L155
BS03 LCJ B G79 K97 I141 C207 D208 F209 G210 V211 S212 L215 G37 K55 I99 C165 D166 F167 G168 V169 S170 L173
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004708 MAP kinase kinase activity
GO:0004712 protein serine/threonine/tyrosine kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005078 MAP-kinase scaffold activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030295 protein kinase activator activity
GO:0043539 protein serine/threonine kinase activator activity
GO:0097110 scaffold protein binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0006468 protein phosphorylation
GO:0006935 chemotaxis
GO:0007165 signal transduction
GO:0007507 heart development
GO:0008285 negative regulation of cell population proliferation
GO:0010628 positive regulation of gene expression
GO:0014044 Schwann cell development
GO:0016310 phosphorylation
GO:0021697 cerebellar cortex formation
GO:0030182 neuron differentiation
GO:0030216 keratinocyte differentiation
GO:0030878 thyroid gland development
GO:0032872 regulation of stress-activated MAPK cascade
GO:0035987 endodermal cell differentiation
GO:0038133 ERBB2-ERBB3 signaling pathway
GO:0042552 myelination
GO:0043410 positive regulation of MAPK cascade
GO:0044342 type B pancreatic cell proliferation
GO:0045893 positive regulation of DNA-templated transcription
GO:0048009 insulin-like growth factor receptor signaling pathway
GO:0048538 thymus development
GO:0048679 regulation of axon regeneration
GO:0048870 cell motility
GO:0050772 positive regulation of axonogenesis
GO:0060020 Bergmann glial cell differentiation
GO:0060324 face development
GO:0060425 lung morphogenesis
GO:0060440 trachea formation
GO:0060502 epithelial cell proliferation involved in lung morphogenesis
GO:0060674 placenta blood vessel development
GO:0060711 labyrinthine layer development
GO:0070371 ERK1 and ERK2 cascade
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:0090170 regulation of Golgi inheritance
GO:0090398 cellular senescence
GO:1903226 positive regulation of endodermal cell differentiation
GO:2000641 regulation of early endosome to late endosome transport
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005813 centrosome
GO:0005816 spindle pole body
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0005925 focal adhesion
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dgt, PDBe:8dgt, PDBj:8dgt
PDBsum8dgt
PubMed37516774
UniProtQ02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 (Gene Name=MAP2K1)

[Back to BioLiP]