Structure of PDB 8dgo Chain B

Receptor sequence

>8dgoB (length=218) Species: 9606 (Homo sapiens) [Search protein sequence]

SMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIP
KNYIEMKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSV
KFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLR
DIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACH
GQTGMFPRNYVTPVNRNV

3D structure

PDB

8dgo Structural mapping of PEAK pseudokinase interactions identifies 14-3-3 as a molecular switch for PEAK3 signaling.

Chain

Resolution

2.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	R67 R86 S96 Q106 H107 F108 K109 W121	R68 R87 S97 Q107 H108 F109 K110 W122

Gene Ontology

	Molecular Function
GO:0001784	phosphotyrosine residue binding
GO:0003723	RNA binding
GO:0005068	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005091	guanyl-nucleotide exchange factor adaptor activity
GO:0005154	epidermal growth factor receptor binding
GO:0005168	neurotrophin TRKA receptor binding
GO:0005515	protein binding
GO:0017124	SH3 domain binding
GO:0019901	protein kinase binding
GO:0019903	protein phosphatase binding
GO:0019904	protein domain specific binding
GO:0030674	protein-macromolecule adaptor activity
GO:0042802	identical protein binding
GO:0043560	insulin receptor substrate binding
GO:0046875	ephrin receptor binding

	Biological Process
GO:0007165	signal transduction
GO:0007173	epidermal growth factor receptor signaling pathway
GO:0007265	Ras protein signal transduction
GO:0008286	insulin receptor signaling pathway
GO:0008543	fibroblast growth factor receptor signaling pathway
GO:0014044	Schwann cell development
GO:0030036	actin cytoskeleton organization
GO:0030838	positive regulation of actin filament polymerization
GO:0031623	receptor internalization
GO:0035987	endodermal cell differentiation
GO:0042110	T cell activation
GO:0042267	natural killer cell mediated cytotoxicity
GO:0042552	myelination
GO:0042770	signal transduction in response to DNA damage
GO:0043408	regulation of MAPK cascade
GO:0048009	insulin-like growth factor receptor signaling pathway
GO:0048646	anatomical structure formation involved in morphogenesis
GO:0050853	B cell receptor signaling pathway
GO:0060670	branching involved in labyrinthine layer morphogenesis
GO:0071479	cellular response to ionizing radiation
GO:2000379	positive regulation of reactive oxygen species metabolic process

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005768	endosome
GO:0005794	Golgi apparatus
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0005938	cell cortex
GO:0008180	COP9 signalosome
GO:0012506	vesicle membrane
GO:0016020	membrane
GO:0070062	extracellular exosome
GO:0070436	Grb2-EGFR complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8dgo, PDBe:8dgo, PDBj:8dgo
PDBsum	8dgo
PubMed	37336884
UniProt	P62993\|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]