Structure of PDB 8d96 Chain B

Receptor sequence
>8d96B (length=187) Species: 9606 (Homo sapiens) [Search protein sequence]
KISLDQIDLLSTKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLT
LEQALQFWKQEFIKGKMDPDKFDKGYSYNIRHSFGKEGKRTDYTPFSCLK
IILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTH
YQVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILN
3D structure
PDB8d96 Structures of human primosome elongation complexes.
ChainB
Resolution3.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.7.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B H300 R302 H303 R306 Y345 H31 R33 H34 R37 Y76
BS02 dna B M307 Y347 N348 H351 G357 K358 T360 D361 Y362 T363 F365 N445 M38 Y78 N79 H82 G88 K89 T91 D92 Y93 T94 F96 N176
BS03 SF4 B P285 C287 C367 I371 C384 C424 P16 C18 C98 I102 C115 C155
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0071667 DNA/RNA hybrid binding
Biological Process
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006269 DNA replication, synthesis of primer
GO:0006270 DNA replication initiation
GO:1903934 positive regulation of DNA primase activity
Cellular Component
GO:0005654 nucleoplasm
GO:0005658 alpha DNA polymerase:primase complex
GO:1990077 primosome complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8d96, PDBe:8d96, PDBj:8d96
PDBsum8d96
PubMed37069376
UniProtP49643|PRI2_HUMAN DNA primase large subunit (Gene Name=PRIM2)

[Back to BioLiP]