Structure of PDB 8czk Chain B

Receptor sequence

>8czkB (length=400) Species: 9606 (Homo sapiens)

HMAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMER
GLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCL
TKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPN
EMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNF
TAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVD
YVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYL
CDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRAC
KFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL

3D structure

• PDB: 8czk The mechanism of thia-Michael addition catalyzed by LanC enzymes.
• Chain: B
• Resolution: 1.91 Å

Enzymatic activity

• Enzyme Commision number: 2.5.1.18: glutathione transferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	N192 R195 K196	N193 R196 K197
BS02	peptide	B	Y62 Y210 E212 H219 P263 C264 D267 C276 H277	Y63 Y211 E213 H220 P264 C265 D268 C277 H278
BS03	ZN	B	C276 C322 H323	C277 C323 H324
BS04	GSH	B	R4 L272 H274 C276 K317 H323 R364 P366 D367 E374	R5 L273 H275 C277 K318 H324 R365 P367 D368 E375

Gene Ontology

Molecular Function

• GO:0004364 glutathione transferase activity
• GO:0004930 G protein-coupled receptor activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016740 transferase activity
• GO:0017124 SH3 domain binding
• GO:0043295 glutathione binding
• GO:0046872 metal ion binding
• GO:0050750 low-density lipoprotein particle receptor binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0031179 peptide modification
• GO:1990748 cellular detoxification

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane

External links

• PDB: RCSB:8czk, PDBe:8czk, PDBj:8czk
• PDBsum: 8czk
• PubMed: 36634136
• UniProt: O43813|LANC1_HUMAN Glutathione S-transferase LANCL1 (Gene Name=LANCL1)