Structure of PDB 8cx0 Chain B

Receptor sequence
>8cx0B (length=176) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPR
ISSEVHIPLGDARLVITTYWGLHTGERDWHLGQGVSIEWRKKRYSTQVDP
ELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHNKVGSLQYLAL
AALITPKKIKPPLPSVTKLTEDRWNK
3D structure
PDB8cx0 The structural basis for HIV-1 Vif antagonism of human APOBEC3G.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B S23 K26 H27 Y30 V31 Y40 H42 H43 S23 K26 H27 Y30 V31 Y40 H42 H43
BS02 ZN B H108 C114 C133 H139 H108 C114 C133 H139
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008289 lipid binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0019058 viral life cycle
GO:0019079 viral genome replication
GO:0039537 symbiont-mediated suppression of cytoplasmic pattern recognition receptor signaling pathway
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0075528 perturbation by virus of host immune response
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0020002 host cell plasma membrane
GO:0030430 host cell cytoplasm
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cx0, PDBe:8cx0, PDBj:8cx0
PDBsum8cx0
PubMed36754086
UniProtP69723|VIF_HV1H2 Virion infectivity factor (Gene Name=vif)

[Back to BioLiP]