Structure of PDB 8cwl Chain B

Receptor sequence

>8cwlB (length=255) Species: 9606 (Homo sapiens) [Search protein sequence]

MVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDE
QFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWE
KTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVY
CASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMG
QYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGI
HFQDY

3D structure

PDB

8cwl Small molecule inhibitors of 15-PGDH exploit a physiologic induced-fit closing system.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

1.1.1.-
1.1.1.141: 15-hydroxyprostaglandin dehydrogenase (NAD(+)).
1.1.1.232: 15-hydroxyicosatetraenoate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	B	G12 Q15 I17 D36 W37 V65 A92 G93 I106 M136 S138 Y151 K155 P183 V186 T188 I190	G11 Q14 I16 D35 W36 V64 A91 G92 I105 M135 S137 Y150 K154 P182 V185 T187 I189
BS02	RLD	B	N95 S138 L139 M143 Y151 G184 F185 I190 I194 M213 Y217	N94 S137 L138 M142 Y150 G183 F184 I189 I193 M212 Y216

Gene Ontology

	Molecular Function
GO:0004957	prostaglandin E receptor activity
GO:0016404	15-hydroxyprostaglandin dehydrogenase (NAD+) activity
GO:0016491	oxidoreductase activity
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0042802	identical protein binding
GO:0051287	NAD binding
GO:0070403	NAD+ binding

	Biological Process
GO:0001822	kidney development
GO:0006693	prostaglandin metabolic process
GO:0007179	transforming growth factor beta receptor signaling pathway
GO:0007565	female pregnancy
GO:0007567	parturition
GO:0019372	lipoxygenase pathway
GO:0030728	ovulation
GO:0032355	response to estradiol
GO:0032496	response to lipopolysaccharide
GO:0043065	positive regulation of apoptotic process
GO:0045471	response to ethanol
GO:0045786	negative regulation of cell cycle
GO:0070493	thrombin-activated receptor signaling pathway
GO:0097070	ductus arteriosus closure
GO:1904707	positive regulation of vascular associated smooth muscle cell proliferation
GO:1905828	regulation of prostaglandin catabolic process

	Cellular Component
GO:0005615	extracellular space
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016323	basolateral plasma membrane
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8cwl, PDBe:8cwl, PDBj:8cwl
PDBsum	8cwl
PubMed	36774348
UniProt	P15428\|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] (Gene Name=HPGD)

[Back to BioLiP]