Structure of PDB 8ctc Chain B

Receptor sequence
>8ctcB (length=406) Species: 9606 (Homo sapiens) [Search protein sequence]
NNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILMRMLKLI
ILPLIISSMITGVAALDSNVSGKIGLRAVVYYFATTLIAVILGIVLVVSI
KPGSTVDAMLDLIRNMFPENLVQAAFQQYKTKREEYKIVGMYSDGINVLG
LIVFALVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMWYMPLGILF
LIAGCIIEVEDWEIFRKLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPF
RFAMGMAQALLTALMISSSSATLPVTFRCAEENNQVDKRITRFVLPVGAT
INMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQA
GLVTMVIVLSAVGLPAEDVTLIIAVDCLLDRFRTMVNVLGDAFGTGIVEK
LSKKEL
3D structure
PDB8ctc Symport and antiport mechanisms of human glutamate transporters.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLU B S332 S333 M367 T370 G410 A414 D444 R447 S268 S269 M303 T306 G346 A350 D380 R383
BS02 NA B S333 G362 A363 N366 N451 D455 S269 G298 A299 N302 N387 D391
BS03 NA B T364 M367 S405 I406 G407 A408 T300 M303 S341 I342 G343 A344
BS04 NA B Y98 T101 T102 N366 D368 Y82 T85 T86 N302 D304
Gene Ontology
Molecular Function
GO:0005253 monoatomic anion channel activity
GO:0005313 L-glutamate transmembrane transporter activity
GO:0005314 high-affinity L-glutamate transmembrane transporter activity
GO:0005515 protein binding
GO:0015108 chloride transmembrane transporter activity
GO:0015179 L-amino acid transmembrane transporter activity
GO:0015183 L-aspartate transmembrane transporter activity
GO:0015293 symporter activity
GO:0015501 glutamate:sodium symporter activity
GO:0016595 glutamate binding
GO:0033229 cysteine transmembrane transporter activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0140010 D-aspartate transmembrane transporter activity
Biological Process
GO:0001662 behavioral fear response
GO:0001975 response to amphetamine
GO:0002027 regulation of heart rate
GO:0006749 glutathione metabolic process
GO:0006750 glutathione biosynthetic process
GO:0006801 superoxide metabolic process
GO:0006811 monoatomic ion transport
GO:0006836 neurotransmitter transport
GO:0006865 amino acid transport
GO:0006882 intracellular zinc ion homeostasis
GO:0007212 G protein-coupled dopamine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007268 chemical synaptic transmission
GO:0007420 brain development
GO:0007611 learning or memory
GO:0007613 memory
GO:0007625 grooming behavior
GO:0007626 locomotory behavior
GO:0009410 response to xenobiotic stimulus
GO:0010460 positive regulation of heart rate
GO:0010467 gene expression
GO:0010842 retina layer formation
GO:0015813 L-glutamate transmembrane transport
GO:0019221 cytokine-mediated signaling pathway
GO:0022008 neurogenesis
GO:0030534 adult behavior
GO:0034599 cellular response to oxidative stress
GO:0035633 maintenance of blood-brain barrier
GO:0036293 response to decreased oxygen levels
GO:0042417 dopamine metabolic process
GO:0042883 cysteine transport
GO:0043278 response to morphine
GO:0043524 negative regulation of neuron apoptotic process
GO:0045184 establishment of protein localization
GO:0048514 blood vessel morphogenesis
GO:0048678 response to axon injury
GO:0050808 synapse organization
GO:0051402 neuron apoptotic process
GO:0051938 L-glutamate import
GO:0060013 righting reflex
GO:0060041 retina development in camera-type eye
GO:0060047 heart contraction
GO:0060291 long-term synaptic potentiation
GO:0061744 motor behavior
GO:0070633 transepithelial transport
GO:0070777 D-aspartate transmembrane transport
GO:0070778 L-aspartate transmembrane transport
GO:0070779 D-aspartate import across plasma membrane
GO:0071242 cellular response to ammonium ion
GO:0071288 cellular response to mercury ion
GO:0071314 cellular response to cocaine
GO:0071407 cellular response to organic cyclic compound
GO:0071577 zinc ion transmembrane transport
GO:0072347 response to anesthetic
GO:0090313 regulation of protein targeting to membrane
GO:0090461 intracellular glutamate homeostasis
GO:0097049 motor neuron apoptotic process
GO:0098712 L-glutamate import across plasma membrane
GO:0098877 neurotransmitter receptor transport to plasma membrane
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:0140009 L-aspartate import across plasma membrane
GO:0150104 transport across blood-brain barrier
GO:1902476 chloride transmembrane transport
GO:1903712 cysteine transmembrane transport
GO:1903926 cellular response to bisphenol A
GO:1990708 conditioned place preference
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005783 endoplasmic reticulum
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0016020 membrane
GO:0016324 apical plasma membrane
GO:0030424 axon
GO:0030425 dendrite
GO:0031901 early endosome membrane
GO:0031902 late endosome membrane
GO:0031982 vesicle
GO:0032279 asymmetric synapse
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0043083 synaptic cleft
GO:0043197 dendritic spine
GO:0043198 dendritic shaft
GO:0043204 perikaryon
GO:0043679 axon terminus
GO:0045121 membrane raft
GO:0045202 synapse
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0071944 cell periphery
GO:0097386 glial cell projection
GO:0097440 apical dendrite
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098793 presynapse
GO:0099544 perisynaptic space
GO:0150002 distal dendrite
GO:1990635 proximal dendrite

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ctc, PDBe:8ctc, PDBj:8ctc
PDBsum8ctc
PubMed37142617
UniProtP43005|EAA3_HUMAN Excitatory amino acid transporter 3 (Gene Name=SLC1A1)

[Back to BioLiP]