Structure of PDB 8cpw Chain B

Receptor sequence

>8cpwB (length=173) Species: 9606 (Homo sapiens)

STSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAK
YFLHQSHEEREHAEKLMKLQNQRGGRIFLQDIQKPDCDDWESGLNAMECA
LHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVT
NLRKMGAPESGLAEYLFDKHTLG

3D structure

• PDB: 8cpw Super-resolution fluorescence imaging of cryosamples does not damage protein structure
• Chain: B
• Resolution: 1.79 Å

Enzymatic activity

• Enzyme Commision number: 1.16.3.1: ferroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	B	D131 E134	D128 E131

Gene Ontology

Molecular Function

• GO:0004322 ferroxidase activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008199 ferric iron binding
• GO:0016491 oxidoreductase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding
• GO:0140315 iron ion sequestering activity

Biological Process

• GO:0006826 iron ion transport
• GO:0006879 intracellular iron ion homeostasis
• GO:0006880 intracellular sequestering of iron ion
• GO:0006955 immune response
• GO:0008285 negative regulation of cell population proliferation
• GO:0048147 negative regulation of fibroblast proliferation
• GO:0110076 negative regulation of ferroptosis

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005764 lysosome
• GO:0005776 autophagosome
• GO:0005829 cytosol
• GO:0016020 membrane
• GO:0031410 cytoplasmic vesicle
• GO:0044754 autolysosome
• GO:0070062 extracellular exosome
• GO:0070288 ferritin complex
• GO:1904724 tertiary granule lumen
• GO:1904813 ficolin-1-rich granule lumen

External links

• PDB: RCSB:8cpw, PDBe:8cpw, PDBj:8cpw
• PDBsum: 8cpw
• PubMed: 37918761
• UniProt: P02794|FRIH_HUMAN Ferritin heavy chain (Gene Name=FTH1)