Structure of PDB 8cop Chain B

Receptor sequence
>8copB (length=159) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSL
PAKVRPLPGRRNVVLSRQADFMASGAEVVGSLEEALTSPETWVIGGGQVY
ALALPYATRCEVTEVDIGLPREAGDALAPVLDETWRGETGEWRFSRSGLR
YRLYSYHRS
3D structure
PDB8cop Expansion of a series of pyrimidine derivatives utilising fragment-based merging showcasing anleads to increased affinity with to Mycobacterium tuberculosis dihydrofolate reductase
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 1.5.1.3: dihydrofolate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NDP B W6 A7 I14 G15 G18 I20 G43 R44 R45 T46 L65 S66 R67 G80 I94 G96 G97 Q98 W6 A7 I14 G15 G18 I20 G43 R44 R45 T46 L65 S66 R67 G80 I94 G96 G97 Q98
BS02 VCI B I5 W6 A7 I20 R23 D27 Q28 F31 I94 I5 W6 A7 I20 R23 D27 Q28 F31 I94
BS03 CO B H38 E90 H38 E90
Gene Ontology
Molecular Function
GO:0004146 dihydrofolate reductase activity
GO:0016491 oxidoreductase activity
GO:0050661 NADP binding
GO:0070401 NADP+ binding
Biological Process
GO:0006730 one-carbon metabolic process
GO:0046452 dihydrofolate metabolic process
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046655 folic acid metabolic process
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cop, PDBe:8cop, PDBj:8cop
PDBsum8cop
PubMed
UniProtP9WNX1|DYR_MYCTU Dihydrofolate reductase (Gene Name=folA)

[Back to BioLiP]