Structure of PDB 8c7s Chain B

Receptor sequence

>8c7sB (length=256) Species: 367830 (Staphylococcus aureus subsp. aureus USA300)

MSLLSKTRELNTLLQKHKGIAVDFKDVAQTISSVTVTNVFIVSRRGKILG
SSLNELLKSQRIIQMLEERHIPSEYTERLMEVKQTESNIDIDNVLTVFPP
ENRELFIDSRTTIFPILGGGERLGTLVLGRVHDDFNENDLVLGEYAATVI
GMEILREKHSEVEKEARDKAAITMAINSLSYSEKEAIEHIFEELGGTEGL
LIASKVADRVGITRSVIVNALRKLESAGVIESRSLGMKGTFIKVKKEKFL
DELEKS

3D structure

• PDB: 8c7s Structural insights into CodY activation and DNA recognition.
• Chain: B
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	S180 S182 T213 S215	S180 S182 T213 S215
BS02	dna	B	S180 S182 T213 S215 S234 L235 G236 M237 K238	S180 S182 T213 S215 S234 L235 G236 M237 K238
BS03	GTP	B	V22 F24 S43 R44 K47 L49 E157 K158	V22 F24 S43 R44 K47 L49 E157 K158
BS04	ILE	B	R61 Y75 T96 V97 F98 P99 P100	R61 Y75 T96 V97 F98 P99 P100

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005525 GTP binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8c7s, PDBe:8c7s, PDBj:8c7s
• PDBsum: 8c7s
• PubMed: 37326020
• UniProt: Q2FHI3|CODY_STAA3 Global transcriptional regulator CodY (Gene Name=codY)