Structure of PDB 8bzm Chain B

Receptor sequence
>8bzmB (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
NTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVDSKAVSRLWGKHKN
KPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMP
3D structure
PDB8bzm FOXK1-ELF1_heterodimer bound to DNA
ChainB
Resolution2.69 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Y261 R266 R269 Y272 K279 L285 Y56 R61 R64 Y67 K74 L80
BS02 dna B Y209 L210 W250 K254 K256 R266 Y270 Y271 R274 Y4 L5 W45 K49 K51 R61 Y65 Y66 R69
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bzm, PDBe:8bzm, PDBj:8bzm
PDBsum8bzm
PubMed
UniProtP32519|ELF1_HUMAN ETS-related transcription factor Elf-1 (Gene Name=ELF1)

[Back to BioLiP]