Structure of PDB 8bwl Chain B |
>8bwlB (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] |
ARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHA VIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVES CGCR |
|
PDB | 8bwl Molecular mechanism of BMP signal control by Twisted gastrulation. |
Chain | B |
Resolution | 1.96 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
G413 D416 |
G16 D19 |
|
|
|