Structure of PDB 8btg Chain B

Receptor sequence

>8btgB (length=335) Species: 1423 (Bacillus subtilis)

NMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKT
HLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNV
DVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLE
DRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQI
DSNIRELEGALIRVVAYSSLINKDINADLAAEALKDISKPKVITIKEIQR
VVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGG
RDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK

3D structure

• PDB: 8btg The bacterial replication origin BUS promotes nucleobase capture.
• Chain: B
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	R379 R412 D413 T415 T416	R268 R301 D302 T304 T305
BS02	dna	B	N187 F189 I190 I193 R202 F218 K222 E223 Q224 E228 S401 L402 P403 H414 T415 I418	N79 F81 I82 I85 R94 F110 K114 E115 Q116 E120 S290 L291 P292 H303 T304 I307
BS03	MG	B	K157 D214 S246	K49 D106 S138
BS04	ATP	B	K114 Y115 F120 V121 V153 G154 L155 G156 K157 T158 H159 K288 I312 R313 E316	K6 Y7 F12 V13 V45 G46 L47 G48 K49 T50 H51 K180 I204 R205 E208

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003688 DNA replication origin binding
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006260 DNA replication
• GO:0006270 DNA replication initiation
• GO:0006275 regulation of DNA replication

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:1990101 DnaA-oriC complex

External links

• PDB: RCSB:8btg, PDBe:8btg, PDBj:8btg
• PDBsum: 8btg
• PubMed: 38097584
• UniProt: P05648|DNAA_BACSU Chromosomal replication initiator protein DnaA (Gene Name=dnaA)