Structure of PDB 8bcx Chain B

Receptor sequence

>8bcxB (length=434) Species: 269799 (Geobacter metallireducens GS-15)

IPDGEVDPAVWGKAYPTEYEMWKKTKRGFDADHVTYDKLSEFPYMALLFN
GWGFGIAYNEPRGHANMVRDQLEIDSARLKSGGVCLTCKTPYAPKLEKEM
GIDYFKTPFKDVLAKIPEKHKTLGVACIDCHDNKDMSLRISRGFTLGEAL
KKLGVDQAKLSRQEMRSLVCAQCHVTYNIPKDADKKSIGVYFPWQGSKMG
NISVENIIKQIRSDASVGEWTQTVTGFKLGFIRHPEYELFSNNSVHWKAG
AACTDCHMPYTVSDHRVMSPLKNDMKACIQCHTEKPEWLRDQVIAIQDRT
VSLMLRSGYATATVAKLFEKAHAAQAQGKQIDKALYDRAKDLYEEAFYRC
VFIGAENSVGFHNPTEAMRVLGDATAFATKAEALLRQALAKAGVDVPLTV
NLELNKYLDQRGEKKLTFDPKVEIKDPYGVQVRF

3D structure

• PDB: 8bcx An unusual active site architecture in cytochrome c nitrite reductase NrfA-1 from Geobacter metallireducens.
• Chain: B
• Resolution: 1.941 Å

Enzymatic activity

• Enzyme Commision number: 1.7.2.2: nitrite reductase (cytochrome; ammonia-forming).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	B	D80 L120 C133 C136 K137 C221 H222 Y225 H282 E284	D32 L72 C85 C88 K89 C173 H174 Y177 H234 E236
BS02	HEC	B	R75 H222 E284 F288 H294 C301 C304 H305 S323 P324 L325 F415 H416	R27 H174 E236 F240 H246 C253 C256 H257 S269 P270 L271 F361 H362
BS03	HEC	B	H294 A297 C304 C332 C335 H336 F415	H246 A249 C256 C278 C281 H282 F361
BS04	HEC	B	G111 H112 M115 C136 V173 R190 V217 C218 C221 H222 V321	G63 H64 M67 C88 V125 R142 V169 C170 C173 H174 V267
BS05	HEC	B	Y52 E55 W59 A174 C175 C178 H179 M184 L186 R214 V316 S317 H319	Y15 E18 W22 A126 C127 C130 H131 M136 L138 R166 V262 S263 H265

Gene Ontology

Molecular Function

• GO:0042279 nitrite reductase (cytochrome, ammonia-forming) activity

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:8bcx, PDBe:8bcx, PDBj:8bcx
• PDBsum: 8bcx
• PubMed: 37460131
• UniProt: Q39YY5