Structure of PDB 8bah Chain B

Receptor sequence

>8bahB (length=398) Species: 9606 (Homo sapiens) [Search protein sequence]

TADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEV
DFILLGGDLFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFG
FSKFPWVNYQDGNLNISIPVFSIHGNNDDPTGADALCALDILSCAGFVNH
FGRSMSVEKIDISPVLLQKGSTKIALYGLGSIPDERLYRMFVNKKVTMLR
PKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDLVIWGHEHECKIA
PTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIPLH
TVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERL
GNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFR

3D structure

PDB

8bah Cryo-EM structure of the Mre11-Rad50-Nbs1 complex reveals the molecular mechanism of scaffolding functions.

Chain

Resolution

4.13 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MN	B	D20 H22 D60 H247	D18 H20 D58 H245
BS02	MN	B	D60 N128 H217 H245	D58 N126 H215 H243

Gene Ontology

	Molecular Function
GO:0000014	single-stranded DNA endodeoxyribonuclease activity
GO:0003677	DNA binding
GO:0003678	DNA helicase activity
GO:0003690	double-stranded DNA binding
GO:0004518	nuclease activity
GO:0004519	endonuclease activity
GO:0004520	DNA endonuclease activity
GO:0004527	exonuclease activity
GO:0005515	protein binding
GO:0008296	3'-5'-DNA exonuclease activity
GO:0008408	3'-5' exonuclease activity
GO:0016787	hydrolase activity
GO:0030145	manganese ion binding
GO:0042802	identical protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0000019	regulation of mitotic recombination
GO:0000723	telomere maintenance
GO:0000724	double-strand break repair via homologous recombination
GO:0000729	DNA double-strand break processing
GO:0006281	DNA repair
GO:0006302	double-strand break repair
GO:0006303	double-strand break repair via nonhomologous end joining
GO:0006310	DNA recombination
GO:0006974	DNA damage response
GO:0007004	telomere maintenance via telomerase
GO:0007062	sister chromatid cohesion
GO:0007095	mitotic G2 DNA damage checkpoint signaling
GO:0007129	homologous chromosome pairing at meiosis
GO:0007131	reciprocal meiotic recombination
GO:0008283	cell population proliferation
GO:0031573	mitotic intra-S DNA damage checkpoint signaling
GO:0031860	telomeric 3' overhang formation
GO:0031954	positive regulation of protein autophosphorylation
GO:0032206	positive regulation of telomere maintenance
GO:0032508	DNA duplex unwinding
GO:0033674	positive regulation of kinase activity
GO:0035825	homologous recombination
GO:0042138	meiotic DNA double-strand break formation
GO:0043066	negative regulation of apoptotic process
GO:0044818	mitotic G2/M transition checkpoint
GO:0051276	chromosome organization
GO:0051321	meiotic cell cycle
GO:0062176	R-loop processing
GO:0097552	mitochondrial double-strand break repair via homologous recombination
GO:0110025	DNA strand resection involved in replication fork processing
GO:2001033	negative regulation of double-strand break repair via nonhomologous end joining

	Cellular Component
GO:0000781	chromosome, telomeric region
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005657	replication fork
GO:0005694	chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016605	PML body
GO:0030870	Mre11 complex
GO:0035861	site of double-strand break
GO:0070533	BRCA1-C complex
GO:0098687	chromosomal region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bah, PDBe:8bah, PDBj:8bah
PDBsum	8bah
PubMed	36577401
UniProt	P49959\|MRE11_HUMAN Double-strand break repair protein MRE11 (Gene Name=MRE11)

[Back to BioLiP]