Structure of PDB 8b9u Chain B |
>8b9uB (length=144) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] |
MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVAAKSLE SLGISLEGVRSQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGH NYIGTEHILLGLIREGEGVAAQVLVKLGAELTRVRQQVIQLLSG |
|
PDB | 8b9u Clp-targeting BacPROTACs impair mycobacterial proteostasis and survival. |
Chain | B |
Resolution | 2.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
F2 R10 V14 Q17 |
F2 R10 V14 Q17 |
|
|
|