Structure of PDB 8b61 Chain B |
>8b61B (length=200) Species: 272559 (Bacteroides fragilis NCTC 9343) [Search protein sequence] |
PFDGKTLPRKSGYTTGVTNDWIYFNLRTGEIFNALGVNRDIKEGGQMNRT DWDLAFCGYVMRTNSGTSGIGRGGAADLGYGNYENWTSVAQLPSDLKWVE DNQEVYVTMSQNDWNHYLIENGLDFNSNPWFDPNNGPQKTTTNANPVLAQ AMSFAGPPPVYTPSYHTYVVRTADGKHYFKIQIISWYDGRLSYYCDELQP |
|
PDB | 8b61 Bacteroides fragilis expresses three proteins similar to Porphyromonas gingivalis HmuY: Hemophore-like proteins differentially evolved to participate in heme acquisition in oral and gut microbiomes. |
Chain | B |
Resolution | 1.81 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
P7W |
B |
W143 Y146 T169 |
W114 Y117 T140 |
|
|
|