Structure of PDB 8b2g Chain B |
>8b2gB (length=74) Species: 282147 (Penicillium virgatum) [Search protein sequence] |
YPITGDGVNCRSGPGTSYSVVKSYQKGADVAITCQAPGTDVKGDNIWDKT ADGCYVADYYIKTGSSSYVTAKCD |
|
PDB | 8b2g Module walking using an SH3-like cell-wall-binding domain leads to a new GH184 family of muramidases. |
Chain | B |
Resolution | 1.5 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
Y1 D29 |
Y1 D29 |
|
|
|