Structure of PDB 8b2f Chain B |
>8b2fB (length=74) Species: 223377 (Trichophaea saccata) [Search protein sequence] |
YPVKTDLHCRSSPSTSASIVRTYSSGTEVQIQCQTTGTSVQGSNVWDKTQ HGCYVADYYVKTGHSGIFTTKCGS |
|
PDB | 8b2f Module walking using an SH3-like cell-wall-binding domain leads to a new GH184 family of muramidases. |
Chain | B |
Resolution | 1.183 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
D6 L7 H8 R10 |
D6 L7 H8 R10 |
|
|
|