Structure of PDB 8b1n Chain B

Receptor sequence

>8b1nB (length=410) Species: 768670 (Calditerrivibrio nitroreducens DSM 19672)

HMKRYNVITIFPEMINEIFKYGVLSKGIDIGLFRVNPINLRDYTEDKHKT
VDDYQYGGGHGLVMKPEPIYKAIADLKSKKDTHVVFLDPRGEQFTQKTAE
RLYNYDDITFVCGRYEGIDDRVRELMADEMISIGDFVITGGELAAVTIID
AVARLIPGVLGDENSPNEESFTTGLLEYPHFTRPAEFMGKKVPEVLISGN
HEEIRRWRLTESIKTTLQNRPDMILRKSLSREEEQILWSLTRYNIYVALM
HYPMRDKEGKVVTTSITNMDLHDISRSCRTFGVKNYFVVNPMPAQREIAS
RVVRHWIKYTIITDSLASVIKSIEEKESGSPIIIATTARYQQKAISIEKL
KEIADRPILLLFGTGWGFVDDILEFADYVLKPIHGVGDFNHLSVRSAVAI
YLDRINRSFQ

3D structure

• PDB: 8b1n Are there double knots in proteins? Prediction and in vitro verification based on TrmD-Tm1570 fusion from C. nitroreducens. To be published
• Chain: B
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SAM	B	E168 S169 E176	E169 S170 E177
BS02	MG	B	E167 E168 E176	E168 E169 E177
BS03	SAM	B	L86 D87 P88 G112 Y114 E115 S131 I132 V136 I137 G139 G140	L87 D88 P89 G113 Y115 E116 S132 I133 V137 I138 G140 G141
BS04	SAM	B	T356 A357 G382 W385 G386 I402 N409 H410 L411 V413 A416 Y420	T337 A338 G363 W366 G367 I383 N390 H391 L392 V394 A397 Y401

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity
• GO:0046872 metal ion binding
• GO:0052906 tRNA (guanine(37)-N1)-methyltransferase activity

Biological Process

• GO:0002939 tRNA N1-guanine methylation
• GO:0006400 tRNA modification
• GO:0008033 tRNA processing
• GO:0032259 methylation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:8b1n, PDBe:8b1n, PDBj:8b1n
• PDBsum: 8b1n
• PubMed: 38903539
• UniProt: E4THH1