Structure of PDB 8asf Chain B

Receptor sequence

>8asfB (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 8asf Crystal structure of Thrombin in complex with optimized macrocycles T1 and T3
• Chain: B
• Resolution: 2.58 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E23 I24 G25 M26 P28 W29 D116 H119 C122 Y134 K135 R137 N159 M201 K202 P204 R206 W207	E8 I9 G10 M11 P13 W14 D113 H116 C119 Y134 K135 R137 N157 M204 K205 P207 R211 W212
BS02	NWF	B	Y60A E97A L99 D189 A190 E192 W215 G216 G219 F227 Y228	Y47 E94 L96 D192 A193 E195 W220 G221 G223 F232 Y233

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:8asf, PDBe:8asf, PDBj:8asf
• PDBsum: 8asf
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)