Structure of PDB 8ase Chain B

Receptor sequence

>8aseB (length=253) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHERNIEKISMLEKIYIHPRYNWRENLDRDIALMKL
KKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKG
QPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDS
GGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVID
QFG

3D structure

• PDB: 8ase Crystal structure of Thrombin in complex with optimized macrocycles T1 and T3
• Chain: B
• Resolution: 2.55 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E23 I24 G25 M26 W29 S48 D49 F114 D116 H119 P120 V121 C122 Y134 K135 G136 R137 N159 K202 P204 N205 R206 W207	E8 I9 G10 M11 W14 S34 D35 F106 D108 H111 P112 V113 C114 Y129 K130 G131 R132 N159 K207 P209 N212 R213 W214
BS02	NWR	B	Y60A W60D N98 L99 E192 V213 W215 G216	Y47 W50 N90 L91 E197 V220 W222 G223

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:8ase, PDBe:8ase, PDBj:8ase
• PDBsum: 8ase
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)