Structure of PDB 8alh Chain B

Receptor sequence

>8alhB (length=171) Species: 9606 (Homo sapiens)

SKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQF
FPFGDPTKFATFVFNVFDENKDGRIEFSEFIQALSVTSRGTLDEKLRWAF
KLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAM
MDKNADGKLTLQEFQEGSKAD

3D structure

• PDB: 8alh The neuronal calcium sensor NCS-1 regulates the phosphorylation state and activity of the Ga chaperone and GEF Ric-8A.
• Chain: B
• Resolution: 1.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	W30 G33 D37 I51 Y52 F55 F64 F72 F85 A88 L89 T92 W103 A104 Y108 V125 R148 F169 G172	W25 G28 D32 I46 Y47 F50 F59 F67 F80 A83 L84 T87 W98 A99 Y103 V120 R143 F164 G167
BS02	CA	B	D73 N75 D77 R79 E84	D68 N70 D72 R74 E79
BS03	CA	B	D109 D111 D113 Y115 E120	D104 D106 D108 Y110 E115

Gene Ontology

Molecular Function

• GO:0005245 voltage-gated calcium channel activity
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0008048 calcium sensitive guanylate cyclase activator activity
• GO:0046872 metal ion binding

Biological Process

• GO:0010975 regulation of neuron projection development
• GO:0070588 calcium ion transmembrane transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0005794 Golgi apparatus
• GO:0005886 plasma membrane
• GO:0014069 postsynaptic density
• GO:0030424 axon
• GO:0030425 dendrite
• GO:0043231 intracellular membrane-bounded organelle
• GO:0045202 synapse
• GO:0048471 perinuclear region of cytoplasm

External links

• PDB: RCSB:8alh, PDBe:8alh, PDBj:8alh
• PDBsum: 8alh
• PubMed: 38018500
• UniProt: P62166|NCS1_HUMAN Neuronal calcium sensor 1 (Gene Name=NCS1)