Structure of PDB 8ak6 Chain B

Receptor sequence

>8ak6B (length=277) Species: 9606 (Homo sapiens)

KGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDF
RGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQN
VDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGR
LCTVACRGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRP
SGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGL
EIPAWDGPRVLERALPPLPRPPTPKLE

3D structure

• PDB: 8ak6 Development of novel Sirtuin 6 inhibitors and activators based on a protein crystallography-based fragment screen
• Chain: B
• Resolution: 1.98 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.-
  2.3.1.286: protein acetyllysine N-acetyltransferase.
  2.4.2.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AR6	B	G52 G54 T57 D63 F64 R65 Q113 H133 G214 T215 S216 I219 N240 L241 Q242 Y257 V258	G38 G40 T43 D49 F50 R51 Q99 H119 G193 T194 S195 I198 N219 L220 Q221 Y236 V237
BS02	ZN	B	C141 C144 C166 C177	C127 C130 C152 C156
BS03	08D	B	I61 P62 F64 V70 F82 F86 M157	I47 P48 F50 V56 F68 F72 M143

Gene Ontology

Molecular Function

• GO:0070403 NAD+ binding

External links

• PDB: RCSB:8ak6, PDBe:8ak6, PDBj:8ak6
• PDBsum: 8ak6
• UniProt: Q8N6T7|SIR6_HUMAN NAD-dependent protein deacylase sirtuin-6 (Gene Name=SIRT6)