Structure of PDB 8aht Chain B

Receptor sequence

>8ahtB (length=140) Species: 5833 (Plasmodium falciparum)

KLTEEQISEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMI
NEIDTDGNGTIDFPEFLTLMARKLKDTELIEAFRVFDRDGDGYISADELR
HVMTNLGEKLTNEEVDEMIREADIDGDGQINYEEFVKMMI

3D structure

• PDB: 8aht Structures of calmodulin-melittin complexes show multiple binding modes lacking classical anchoring interactions.
• Chain: B
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E7 E11 E14 M36 L39 Q41 K75 M109 E114 E120 E123 M124 E127 M144 M145	E5 E9 E12 M34 L37 Q39 K73 M103 E108 E114 E117 M118 E121 M138 M139
BS02	CA	B	D20 D22 D24 T26 E31	D18 D20 D22 T24 E29
BS03	CA	B	D56 D58 N60 T62 E67	D54 D56 N58 T60 E65
BS04	CA	B	D93 D95 D97 Y99 E104	D87 D89 D91 Y93 E98
BS05	CA	B	D129 D131 D133 Q135 E140	D123 D125 D127 Q129 E134

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0008047 enzyme activator activity
• GO:0046872 metal ion binding
• GO:0061891 calcium ion sensor activity

Cellular Component

• GO:0005737 cytoplasm
• GO:0020007 apical complex

External links

• PDB: RCSB:8aht, PDBe:8aht, PDBj:8aht
• PDBsum: 8aht
• PubMed: 36906144
• UniProt: P62203|CALM_PLAF7 Calmodulin (Gene Name=CAM)