Structure of PDB 8age Chain B

Receptor sequence

>8ageB (length=33) Species: 4932 (Saccharomyces cerevisiae)

MISDEQLNSLAITFGIVMMTLIVIYHAVDSTMS

3D structure

• PDB: 8age Molecular basis for glycan recognition and reaction priming of eukaryotic oligosaccharyltransferase.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CPL	B	M1 I2	M1 I2

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0030674 protein-macromolecule adaptor activity

Biological Process

• GO:0006486 protein glycosylation
• GO:0006487 protein N-linked glycosylation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005783 endoplasmic reticulum
• GO:0005789 endoplasmic reticulum membrane
• GO:0008250 oligosaccharyltransferase complex
• GO:0016020 membrane

External links

• PDB: RCSB:8age, PDBe:8age, PDBj:8age
• PDBsum: 8age
• PubMed: 36435935
• UniProt: Q99380|OST4_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit OST4 (Gene Name=OST4)