Structure of PDB 8ag0 Chain B

Receptor sequence
>8ag0B (length=426) Species: 9606,83333 [Search protein sequence]
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQ
VAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRY
NGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMF
NLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLI
KNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPT
FKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVIN
AASGRQTVDAALAAAQTNAAANSVGEACTDMKREYDQCFNRWFAEKFLKG
DSSGDPCTDLFKRYQQCVQKAIKEKE
3D structure
PDB8ag0 An intermolecular hydrogen bonded network in the PRELID-TRIAP protein family plays a role in lipid sensing.
ChainB
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BGC B D14 K15 E111 E153 Y155 D15 K16 E112 E154 Y156
BS02 GLC B W62 D65 R66 E153 P154 Y155 W340 R344 W63 D66 R67 E154 P155 Y156 W341 R345
Gene Ontology
Molecular Function
GO:0002039 p53 binding
GO:0005515 protein binding
GO:0015144 carbohydrate transmembrane transporter activity
GO:1901982 maltose binding
GO:1990050 phosphatidic acid transfer activity
Biological Process
GO:0006869 lipid transport
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0006977 DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest
GO:0008643 carbohydrate transport
GO:0015768 maltose transport
GO:0015914 phospholipid transport
GO:0030330 DNA damage response, signal transduction by p53 class mediator
GO:0034219 carbohydrate transmembrane transport
GO:0034289 detection of maltose stimulus
GO:0034644 cellular response to UV
GO:0042956 maltodextrin transmembrane transport
GO:0043066 negative regulation of apoptotic process
GO:0043154 negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045332 phospholipid translocation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0055085 transmembrane transport
GO:0060326 cell chemotaxis
GO:0090201 negative regulation of release of cytochrome c from mitochondria
GO:0097035 regulation of membrane lipid distribution
GO:0120009 intermembrane lipid transfer
GO:1902166 negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:2001140 positive regulation of phospholipid transport
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005758 mitochondrial intermembrane space
GO:0016020 membrane
GO:0030288 outer membrane-bounded periplasmic space
GO:0032991 protein-containing complex
GO:0042597 periplasmic space
GO:0043190 ATP-binding cassette (ABC) transporter complex
GO:0055052 ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:1990060 maltose transport complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ag0, PDBe:8ag0, PDBj:8ag0
PDBsum8ag0
PubMed36309326
UniProtO43715;
P0AEX9|MALE_ECOLI Maltose/maltodextrin-binding periplasmic protein (Gene Name=malE)

[Back to BioLiP]