Structure of PDB 8ad4 Chain B

Receptor sequence

>8ad4B (length=280) Species: 666 (Vibrio cholerae)

HMVKKWECTVISNDNKATFIKELKLAIPDGESVPFRAGGYIQIEAPAHHV
KYADFDVPEKYRGDWDKFNLFRYESKVDEPIIRAYSMANYPEEFGIIMLN
VRIATPPPNNPNVPPGQMSSYIWSLKAGDKCTISGPFGEFFAKDTDAEMV
FIGGGAGMAPMRSHIFDQLKRLKSKRKMSYWYGARSKREMFYVEDFDGLA
AENDNFVWHCALSDPQPEDNWTGYTGFIHNVLYENYLKDHEAPEDCEYYM
CGPPMMNAAVINMLKNLGVEEENILLDDFG

3D structure

• PDB: 8ad4 Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: B
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	B	Y167 R210 A211 Y212 S213 N227 A231 T232 V240 P241 G243 Q244 M245 S246 F406	Y40 R83 A84 Y85 S86 N100 A104 T105 V113 P114 G116 Q117 M118 S119 F279
BS02	NAI	B	R229 G282 A283 G284 G310 A311 R312 S340 F354 H356 G379 P380 P381 M382 M383 F406	R102 G155 A156 G157 G183 A184 R185 S213 F227 H229 G252 P253 P254 M255 M256 F279
BS03	NAI	B	H336 C337 W348 G350 Y351	H209 C210 W221 G223 Y224
BS04	NAI	B	K304 M305 S306 N332 V334 H336 Y363	K177 M178 S179 N205 V207 H209 Y236
BS05	NA	B	K143 A144 Y188 R315 E316 M317	K16 A17 Y61 R188 E189 M190
BS06	NA	B	A327 N330 D331 F333	A200 N203 D204 F206

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006814 sodium ion transport

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8ad4, PDBe:8ad4, PDBj:8ad4
• PDBsum: 8ad4
• PubMed: 37710014
• UniProt: A5F5Y4|NQRF_VIBC3 Na(+)-translocating NADH-quinone reductase subunit F (Gene Name=nqrF)