Structure of PDB 8acw Chain B

Receptor sequence

>8acwB (length=380) Species: 666 (Vibrio cholerae)

YTPGLVTKRSSHVRDSVDLKRIMIMVWLAVFPAMFWGMYNAGGQAIAALN
HLYSGDQLAAIVAGNWHYWLTEMLGGTMSSDAGWGSKMLLGATYFLPIYA
TVFIVGGFWEVLFCMVRKHEVNEGFFVTSILFALIVPPTLPLWQAALGIT
FGVVVAKEVFGGTGRNFLNPALAGRAFLFFAYPAQISGDLVWTAADGYSG
ATALSQWAQGGAGALINNATGQTITWMDAFIGNIPGSIGEVSTLALMIGA
AFIVYMGIASWRIIGGVMIGMILLSTLFNVIGSDTNAMFNMPWHWHLVLG
GFAFGMFFMATDPVSASFTNSGKWAYGILIGVMCVLIRVVNPAYPEGMML
AILFANLFAPLFDHVVVERNIKRRLARYGK

3D structure

• PDB: 8acw Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: B
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	B	I169 R209 F213 W226 T236 L238 S239 S271 E274 G334 G335 P379 E380 M383	I135 R175 F179 W192 T202 L204 S205 S237 E240 G300 G301 P345 E346 M349
BS02	RBF	B	V60 V161 T162 L165 T197 G198 N200 N203 P204 A205 I292 F342 M343 D346 P347 V348	V26 V127 T128 L131 T163 G164 N166 N169 P170 A171 I258 F308 M309 D312 P313 V314

Gene Ontology

Molecular Function

• GO:0010181 FMN binding
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:1902444 riboflavin binding

Biological Process

• GO:0006814 sodium ion transport
• GO:0022904 respiratory electron transport chain
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:8acw, PDBe:8acw, PDBj:8acw
• PDBsum: 8acw
• PubMed: 37710014
• UniProt: A5F5X0|NQRB_VIBC3 Na(+)-translocating NADH-quinone reductase subunit B (Gene Name=nqrB)