Structure of PDB 8a8m Chain B

Receptor sequence
>8a8mB (length=298) Species: 9606 (Homo sapiens) [Search protein sequence]
LLERRGVSELPPLYCISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHV
PSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREG
DVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKL
SVIHRDVKPSNVLINALGQVKMCDFGISGYLPYMAPERINPELNQKGYSV
KSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAE
FVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD
3D structure
PDB8a8m Architecture of the MKK6-p38 alpha complex defines the basis of MAPK specificity and activation.
ChainB
Resolution4.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.12.2: mitogen-activated protein kinase kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AP2 B A80 K82 E130 L131 M132 S135 K138 S183 L186 D197 A57 K59 E107 L108 M109 S112 K115 S160 L163 D174
BS02 MG B D197 G199 D174 G176
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0004708 MAP kinase kinase activity
GO:0004713 protein tyrosine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0019901 protein kinase binding
GO:0106310 protein serine kinase activity
Biological Process
GO:0000165 MAPK cascade
GO:0001649 osteoblast differentiation
GO:0002931 response to ischemia
GO:0006468 protein phosphorylation
GO:0006915 apoptotic process
GO:0007165 signal transduction
GO:0009410 response to xenobiotic stimulus
GO:0016310 phosphorylation
GO:0022602 ovulation cycle process
GO:0031098 stress-activated protein kinase signaling cascade
GO:0032308 positive regulation of prostaglandin secretion
GO:0035872 nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway
GO:0038066 p38MAPK cascade
GO:0042770 signal transduction in response to DNA damage
GO:0043065 positive regulation of apoptotic process
GO:0043410 positive regulation of MAPK cascade
GO:0051403 stress-activated MAPK cascade
GO:0051726 regulation of cell cycle
GO:0051770 positive regulation of nitric-oxide synthase biosynthetic process
GO:0060048 cardiac muscle contraction
GO:0060348 bone development
GO:0072709 cellular response to sorbitol
GO:0090398 cellular senescence
GO:0120163 negative regulation of cold-induced thermogenesis
GO:1901796 regulation of signal transduction by p53 class mediator
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a8m, PDBe:8a8m, PDBj:8a8m
PDBsum8a8m
PubMed37708276
UniProtP52564|MP2K6_HUMAN Dual specificity mitogen-activated protein kinase kinase 6 (Gene Name=MAP2K6)

[Back to BioLiP]