Structure of PDB 7zqs Chain B

Receptor sequence
>7zqsB (length=639) Species: 9606 (Homo sapiens) [Search protein sequence]
RRLYWDDLKRKLSEKLDSTDFTGTIKLLNENSYVPREAGSQKDENLALYV
ENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGY
VAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVA
NAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHT
QFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSE
SKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKS
GVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEG
YLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTG
QFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTT
MDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLL
SFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRF
VMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLR
KQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDN
3D structure
PDB7zqs Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
ChainB
Resolution2.54 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B L619 R623 R629 Y643 R646 G647 F650 R651 L500 R504 R510 Y524 R527 G528 F531 R532
Gene Ontology
Molecular Function
GO:0001618 virus receptor activity
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0004998 transferrin receptor activity
GO:0005515 protein binding
GO:0019901 protein kinase binding
GO:0030544 Hsp70 protein binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0044877 protein-containing complex binding
GO:0051087 protein-folding chaperone binding
Biological Process
GO:0001558 regulation of cell growth
GO:0001666 response to hypoxia
GO:0001934 positive regulation of protein phosphorylation
GO:0006826 iron ion transport
GO:0006879 intracellular iron ion homeostasis
GO:0006897 endocytosis
GO:0006953 acute-phase response
GO:0007165 signal transduction
GO:0007584 response to nutrient
GO:0010039 response to iron ion
GO:0010042 response to manganese ion
GO:0010628 positive regulation of gene expression
GO:0010637 negative regulation of mitochondrial fusion
GO:0030316 osteoclast differentiation
GO:0030890 positive regulation of B cell proliferation
GO:0031334 positive regulation of protein-containing complex assembly
GO:0031623 receptor internalization
GO:0032526 response to retinoic acid
GO:0033138 positive regulation of peptidyl-serine phosphorylation
GO:0033572 transferrin transport
GO:0035556 intracellular signal transduction
GO:0042102 positive regulation of T cell proliferation
GO:0042127 regulation of cell population proliferation
GO:0043066 negative regulation of apoptotic process
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045780 positive regulation of bone resorption
GO:0045830 positive regulation of isotype switching
GO:0046688 response to copper ion
GO:0046718 symbiont entry into host cell
GO:0051092 positive regulation of NF-kappaB transcription factor activity
GO:0060586 multicellular organismal-level iron ion homeostasis
GO:0071466 cellular response to xenobiotic stimulus
GO:0099072 regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0150104 transport across blood-brain barrier
GO:1900182 positive regulation of protein localization to nucleus
GO:1990830 cellular response to leukemia inhibitory factor
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005768 endosome
GO:0005769 early endosome
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009897 external side of plasma membrane
GO:0009986 cell surface
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0030669 clathrin-coated endocytic vesicle membrane
GO:0031410 cytoplasmic vesicle
GO:0042470 melanosome
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0055037 recycling endosome
GO:0055038 recycling endosome membrane
GO:0070062 extracellular exosome
GO:0072562 blood microparticle
GO:0098794 postsynapse
GO:0098944 postsynaptic recycling endosome membrane
GO:0098978 glutamatergic synapse
GO:1903561 extracellular vesicle
GO:1990712 HFE-transferrin receptor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zqs, PDBe:7zqs, PDBj:7zqs
PDBsum7zqs
PubMed35875870
UniProtP02786|TFR1_HUMAN Transferrin receptor protein 1 (Gene Name=TFRC)

[Back to BioLiP]