Structure of PDB 7zjw Chain B

Receptor sequence
>7zjwB (length=204) Species: 9606 (Homo sapiens) [Search protein sequence]
SKQQPQDNFKNNVKKSQLPVQLDLGGMLTALEKKQHSQHAKQSSKPVVHS
RRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVLG
LREVLKHLKLRKLKCIIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFV
FALNRKALGRSLNKAVPVSVVGIFSYDGAQDQFHKMVELTVAARQAYKTM
LENV
3D structure
PDB7zjw Structure of the mammalian ribosome as it decodes the selenocysteine UGA codon.
ChainB
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B T457 L675 G676 L677 R678 R731 P743 V744 T29 L99 G100 L101 R102 R155 P167 V168
BS02 rna B Q431 Q432 Q434 D435 K442 F655 R658 Q756 Q3 Q4 Q6 D7 K14 F79 R82 Q180
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0035368 selenocysteine insertion sequence binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0001514 selenocysteine incorporation
GO:0006401 RNA catabolic process
GO:0006412 translation
GO:0021756 striatum development
GO:0021884 forebrain neuron development
GO:0048255 mRNA stabilization
GO:2000623 negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zjw, PDBe:7zjw, PDBj:7zjw
PDBsum7zjw
PubMed35709277
UniProtQ96T21|SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 (Gene Name=SECISBP2)

[Back to BioLiP]