Structure of PDB 7zjm Chain B |
>7zjmB (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] |
KPCDYPDIKHGGLYHENMRRPYFPVAVGKYYSYYCDEHFETPSGSYWDHI HCTQDGWSPAVPCLRKCYFPYLENGYNQNHGRKFVQGKSIDVACHPGYAL PKAQTTVTCMENGWSPTPRCIR |
|
PDB | 7zjm Crystal structure of a complex between CspZ from Borrelia burgdorferi strain B408 and human FH SCR domains 6-7 |
Chain | B |
Resolution | 2.59 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H12 E113 |
H10 E111 |
|
|
|