Structure of PDB 7zgp Chain B

Receptor sequence

>7zgpB (length=93) Species: 4932 (Saccharomyces cerevisiae)

SLIHPDTAKYPFKFEPFLRQEYSFSLDPDRPICEFYNSREGPKSCPRGPL
CPKKHVLPIFQNKIVCRHWLRGLCKKNDQCEYLHEYNLRKMPE

3D structure

• PDB: 7zgp Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
• Chain: B
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	I65 C67 R68 H69 L74 C75 K76 E82 Y83	I64 C66 R67 H68 L73 C74 K75 E81 Y82
BS02	ZN	B	C67 C75 C81 H85	C66 C74 C80 H84
BS03	ZN	B	C34 C46 C52 H56	C33 C45 C51 H55

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006397 mRNA processing
• GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled

Cellular Component

• GO:0005634 nucleus
• GO:0005829 cytosol
• GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

External links

• PDB: RCSB:7zgp, PDBe:7zgp, PDBj:7zgp
• PDBsum: 7zgp
• PubMed: 35584695
• UniProt: Q06102|YTH1_YEAST mRNA 3'-end-processing protein YTH1 (Gene Name=YTH1)