Structure of PDB 7zcl Chain B

Receptor sequence
>7zclB (length=227) Species: 1934374 (Achaetomiella virescens) [Search protein sequence]
ALDFSKWKTRQPGEFRAPCPAMNSLANHGFIPRDGRNITVAMLVPVLQEV
FHLSPELAQTISTLGLFTAQDPSKGVFTLDDLNRHNLFEHDASLSREDYY
FHKDASTFRPEVFKKFMSHFKGKEYVTLEDAASARYAMVQESRKKNPTFT
YTVQQRITSYGETIKYFRTIVEPATGKCPVAWIKILFEQERLPYNEGWRP
PKAELSGFSMASDVLELALVTPEKLID
3D structure
PDB7zcl Structural Characterization of Two Short Unspecific Peroxygenases: Two Different Dimeric Arrangements.
ChainB
Resolution1.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG B E89 H90 S93 E89 H90 S93
BS02 HEC B C19 P20 A21 M22 L47 F51 L53 I61 F88 E89 H90 S93 L94 S95 E162 K165 F187 C19 P20 A21 M22 L47 F51 L53 I61 F88 E89 H90 S93 L94 S95 E162 K165 F187
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Feb 19 03:49:16 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7zcl', asym_id = 'B', title = 'Structural Characterization of Two Short Unspeci...eroxygenases: Two Different Dimeric Arrangements.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7zcl', asym_id='B', title='Structural Characterization of Two Short Unspeci...eroxygenases: Two Different Dimeric Arrangements.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004601', uniprot = '', pdbid = '7zcl', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004601', uniprot='', pdbid='7zcl', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>