Structure of PDB 7zc6 Chain B

Receptor sequence

>7zc6B (length=202) Species: 1553 (Clostridium tetanomorphum)

MEGLLFPVLSLGGLGVVFGLLLGYASKKFASSEPKKAYVKCQGTCDKAKE
KYEYYGAMTCVDAANIPGAGSKTCGFGCLGLGSCVQVCAFDAIHVENGIA
VVDEEACTGCGACVSICPKSVIELTPMSKKVRISCNSHDKGIEVKNACSV
GCLSCGLCVRNCPSEAITMVNNLPVIDYDKCTQCGVCVGKCPTKAIVNLN
TN

3D structure

• PDB: 7zc6 Purification and structural characterization of the Na + -translocating ferredoxin: NAD + reductase (Rnf) complex of Clostridium tetanomorphum.
• Chain: B
• Resolution: 4.27 Å

Enzymatic activity

• Enzyme Commision number: 7.-.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	B	C152 C171 T172 G173 C174 G175 C177	C88 C107 T108 G109 C110 G111 C113
BS02	SF4	B	C124 C142 G146 C148 C181	C60 C78 G82 C84 C117
BS03	SF4	B	C105 Q106 G107 C138 G141 C199 C212	C41 Q42 G43 C74 G77 C135 C148
BS04	SF4	B	C216 L217 C219 G220 L221 C222 C255	C152 L153 C155 G156 L157 C158 C191
BS05	SF4	B	C226 C245 Q247 C248 G249 C251	C162 C181 Q183 C184 G185 C187

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:7zc6, PDBe:7zc6, PDBj:7zc6
• PDBsum: 7zc6
• PubMed: 36274063
• UniProt: A0A923E755