Structure of PDB 7zak Chain B

Receptor sequence
>7zakB (length=178) Species: 9606 (Homo sapiens) [Search protein sequence]
TPENYVYQGRQECYAFNGTQRFLERYIYNREEYARFDSDVGEFRAVTELG
RPAAEYWNSQKDILEEKRAVPDRVCRHNYELDEAVTLQRRVQPKVNVSPS
NLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLE
MTPQQGDVYICQVEHTSLDSPVTVEWKA
3D structure
PDB7zak Machine learning predictions of MHC-II specificities reveal alternative binding mode of class II epitopes.
ChainB
Resolution1.62 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B G11 R12 Q13 Y28 Y35 A55 W59 K69 R75 H79 N80 L83 D84 G9 R10 Q11 Y26 Y33 A53 W57 K67 R73 H77 N78 L81 D82
BS02 MG B V141 S142 V131 S132
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 17:20:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7zak', asym_id = 'B', title = 'Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7zak', asym_id='B', title='Machine learning predictions of MHC-II specifici...al alternative binding mode of class II epitopes.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006955,0016020,0019882,0042613', uniprot = '', pdbid = '7zak', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006955,0016020,0019882,0042613', uniprot='', pdbid='7zak', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>