Structure of PDB 7yun Chain B

Receptor sequence
>7yunB (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
FQIEKWQIARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKA
VKPAMNQNEVQEIIGVTKQLFPNTDDVSIRRMIGQKLNNCTK
3D structure
PDB7yun Structural insights into DNA recognition by the BEN domain of the transcription factor BANP.
ChainB
Resolution2.13 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B L211 T212 A214 S216 K225 R253 R254 N261 L38 T39 A41 S43 K52 R80 R81 N88
BS02 dna B Q190 N194 S217 Q258 N262 Q17 N21 S44 Q85 N89
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003714 transcription corepressor activity
Biological Process
GO:0045666 positive regulation of neuron differentiation
GO:0045746 negative regulation of Notch signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7yun, PDBe:7yun, PDBj:7yun
PDBsum7yun
PubMed37086783
UniProtQ5SZJ8|BEND6_HUMAN BEN domain-containing protein 6 (Gene Name=BEND6)

[Back to BioLiP]