Structure of PDB 7yr6 Chain B

Receptor sequence

>7yr6B (length=55) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQR
IQKEK

3D structure

PDB

7yr6 Structural basis of sRNA RsmZ regulation of Pseudomonas aeruginosa virulence.

Chain

Resolution

4.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	B	M1 L2 I3 L4 T5 R7 V8 L23 N28 N35 A36 P37 K38 V40 A41 V42 H43 R44 Y48	M1 L2 I3 L4 T5 R7 V8 L23 N28 N35 A36 P37 K38 V40 A41 V42 H43 R44 Y48

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0006109	regulation of carbohydrate metabolic process
GO:0006402	mRNA catabolic process
GO:0006417	regulation of translation
GO:0009372	quorum sensing
GO:0030254	protein secretion by the type III secretion system
GO:0033103	protein secretion by the type VI secretion system
GO:0043455	regulation of secondary metabolic process
GO:0045947	negative regulation of translational initiation
GO:0045948	positive regulation of translational initiation
GO:1900190	regulation of single-species biofilm formation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

External links

PDB	RCSB:7yr6, PDBe:7yr6, PDBj:7yr6
PDBsum	7yr6
PubMed	36828938
UniProt	O69078\|CSRA_PSEAE Translational regulator CsrA (Gene Name=csrA)